DARPP32 antibody

Catalog No. ABIN4950763

Product Details anti-DARPP32 Antibody

Target: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DARPP32 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP-32 were used as the immunogen for the DARPP-32 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the DARPP-32 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the DARPP-32 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for DARPP32

Target: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Alternative Name: DARPP-32 (PPP1R1B Products)

Synonyms: darpp32 antibody, darpp-32 antibody, Darpp-32 antibody, Darpp32 antibody, DARPP-32 antibody, DARPP32 antibody, AU040756 antibody, protein phosphatase 1 regulatory inhibitor subunit 1B antibody, protein phosphatase 1, regulatory (inhibitor) subunit 1B antibody, protein phosphatase 1 regulatory inhibitor subunit 1B S homeolog antibody, ppp1r1b antibody, PPP1R1B antibody, Ppp1r1b antibody, ppp1r1b.S antibody

Background: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9UD71