EPH Receptor B1 antibody

Catalog No. ABIN4950927

Product Details anti-EPH Receptor B1 Antibody

Target: EPH Receptor B1 (EPHB1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPH Receptor B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the EPHB1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the EPHB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for EPH Receptor B1

Target: EPH Receptor B1 (EPHB1)

Alternative Name: Eph Receptor B1 / EphB1 (EPHB1 Products)

Synonyms: ELK antibody, EPHT2 antibody, Hek6 antibody, NET antibody, ephb1-a antibody, xek antibody, Xek antibody, MGC89790 antibody, EPHB1 antibody, CEK6 antibody, EK6 antibody, 9330129L11 antibody, AW488255 antibody, C130099E04Rik antibody, Cek6 antibody, ENSMUSG00000074119 antibody, Elk antibody, Elkh antibody, Net antibody, Ephb2 antibody, Erk antibody, elk antibody, EPH receptor B1 antibody, EPH receptor B1 S homeolog antibody, ephrin type-B receptor 1 antibody, Eph receptor B1 antibody, EPHB1 antibody, ephb1.S antibody, ephb1 antibody, LOC100467687 antibody, Ephb1 antibody

Background: Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

UniProt: P54762

Pathways: RTK Signaling