LCK antibody

Catalog No. ABIN4951597

Product Details anti-LCK Antibody

Target: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCK antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ of human Lymphocyte-specific protein tyrosine kinase were used as the immunogen for the LCK antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LCK antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LCK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LCK

Target: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Alternative Name: LCK (LCK Products)

Synonyms: zgc:136695 antibody, LCK antibody, Hck-3 antibody, Lsk antibody, Lskt antibody, p56 antibody, p56Lck antibody, LSK antibody, YT16 antibody, p56lck antibody, pp58lck antibody, P56LCK antibody, tkl antibody, Lck1 antibody, Lcktkr antibody, LCK proto-oncogene, Src family tyrosine kinase antibody, lymphocyte protein tyrosine kinase antibody, lck antibody, LCK antibody, Lck antibody

Background: Lck (or lymphocyte-specific protein tyrosine kinase) is a protein found inside specialized cells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.

UniProt: P06239

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling