LIFR antibody

Catalog No. ABIN4951612

Product Details anti-LIFR Antibody

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIFR antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LIFR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LIFR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LIFR

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Alternative Name: LIF Receptor / LIFR (LIFR Products)

Synonyms: A230075M04Rik antibody, AW061234 antibody, LIF antibody, CD118 antibody, LIF-R antibody, SJS2 antibody, STWS antibody, SWS antibody, leukemia inhibitory factor receptor antibody, LIF receptor alpha antibody, leukemia inhibitory factor receptor alpha antibody, Lifr antibody, LOC397451 antibody, LIFR antibody

Background: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

UniProt: P42702

Pathways: JAK-STAT Signaling, Growth Factor Binding