MDM4-binding Protein antibody

Catalog No. ABIN4951699

Product Details anti-MDM4-binding Protein Antibody

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MDM4-binding Protein antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MDM4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MDM4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MDM4-binding Protein

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Alternative Name: MDM4 / MDMX (MDM4 Products)

Synonyms: mdmx antibody, HDMX antibody, MDMX antibody, MRP1 antibody, wu:fa09h09 antibody, wu:fi33d10 antibody, 4933417N07Rik antibody, AA414968 antibody, AL023055 antibody, AU018793 antibody, AU021806 antibody, C85810 antibody, Mdmx antibody, MDM4, p53 regulator S homeolog antibody, MDM4, p53 regulator antibody, transformed mouse 3T3 cell double minute 4 antibody, mdm4.S antibody, MDM4 antibody, Mdm4 antibody, mdm4 antibody

Background: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

UniProt: O15151

Pathways: Cell Division Cycle