SMURF2 antibody

Catalog No. ABIN4952623

Product Details anti-SMURF2 Antibody

Target: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMURF2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ of human SMURF2 were used as the immunogen for the SMURF2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SMURF2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the SMURF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SMURF2

Target: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Alternative Name: SMURF2 (SMURF2 Products)

Synonyms: SMURF2 antibody, 2810411E22Rik antibody, AI558114 antibody, AI649275 antibody, RGD1310067 antibody, wu:fb82a11 antibody, wu:fc41c02 antibody, SMAD specific E3 ubiquitin protein ligase 2 antibody, SMAD specific E3 ubiquitin protein ligase 2 S homeolog antibody, SMURF2 antibody, smurf2 antibody, Smurf2 antibody, smurf2.S antibody

Background: E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression

UniProt: Q9HAU4