Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PTGS2 antibody (Middle Region)

PTGS2 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5518867
  • Target See all PTGS2 Antibodies
    PTGS2 (Prostaglandin-Endoperoxide Synthase 2 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS2))
    Binding Specificity
    • 16
    • 15
    • 10
    • 7
    • 7
    • 6
    • 6
    • 6
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 365-397, Middle Region
    Reactivity
    • 99
    • 53
    • 42
    • 21
    • 5
    • 2
    • 2
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 88
    • 19
    • 2
    Rabbit
    Clonality
    • 86
    • 23
    Polyclonal
    Conjugate
    • 58
    • 9
    • 8
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    This PTGS2 antibody is un-conjugated
    Application
    • 95
    • 40
    • 37
    • 27
    • 27
    • 26
    • 20
    • 19
    • 13
    • 12
    • 8
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for Prostaglandin G/H synthase 2(PTGS2) detection. Tested with WB in Human,Mouse,Rat.
    Sequence
    AEFNTLYHWH PLLPDTFQIH DQKYNYQQFI YNN
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Prostaglandin G/H synthase 2(PTGS2) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
    Protein Name: Prostaglandin G/H synthase 2
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product PTGS2 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Li, Zhou, Wei, Chen, Geng, Zheng, Chai, Li, Jiang: "miR-144 and targets, c-fos and cyclooxygenase-2 (COX2), modulate synthesis of PGE2 in the amnion during pregnancy and labor." in: Scientific reports, Vol. 6, pp. 27914, (2018) (PubMed).

    Wang, Yuan, Wang, Yang, Chen, Liu, Song, Feng, Tan, Jia: "Anti-inflammatory Effects of Phyllanthus emblica L on Benzopyrene-Induced Precancerous Lung Lesion by Regulating the IL-1β/miR-101/Lin28B Signaling Pathway." in: Integrative cancer therapies, Vol. 16, Issue 4, pp. 505-515, (2018) (PubMed).

    Wang, Duan, Wu, Min, Huang, Luo, He: "Effect of cyclooxygenase‑2 inhibition on the development of post‑traumatic stress disorder in rats." in: Molecular medicine reports, Vol. 17, Issue 4, pp. 4925-4932, (2018) (PubMed).

    Sun, Xue, Xue, Ren, Wu, Wang: "Acetylpuerarin protects against OGD-induced cell injury in BV2 microglia by inhibiting HMGB1 release." in: Die Pharmazie, Vol. 73, Issue 2, pp. 92-97, (2018) (PubMed).

    Liu, Jia, Chong, Jiang, Yang, Li, Ma, Sun, Zhou: "Effects of oral cimetidine on the reproductive system of male rats." in: Experimental and therapeutic medicine, Vol. 15, Issue 6, pp. 4643-4650, (2018) (PubMed).

    Ahmadieh, Nourinia, Hafezi-Moghadam, Sabbaghi, Nakao, Zandi, Yaseri, Tofighi, Akbarian: "Intravitreal injection of a Rho-kinase inhibitor (fasudil) combined with bevacizumab versus bevacizumab monotherapy for diabetic macular oedema: a pilot randomised clinical trial." in: The British journal of ophthalmology, (2018) (PubMed).

    Alsaegh, Miyashita, Taniguchi, Zhu: "Odontogenic epithelial proliferation is correlated with COX-2 expression in dentigerous cyst and ameloblastoma." in: Experimental and therapeutic medicine, Vol. 13, Issue 1, pp. 247-253, (2017) (PubMed).

    Sun, Yang, Zhang, Zhao: "Esculentoside A ameliorates cecal ligation and puncture-induced acute kidney injury in rats." in: Experimental animals, (2017) (PubMed).

    Jiang, Tian, Tang, Ou, Xu et al.: "Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) Downregulates the Expression of Protumor Factors Cyclooxygenase-2 and Inducible Nitric Oxide Synthase in a GM-CSF Receptor-Independent Manner ..." in: Mediators of inflammation, Vol. 2015, pp. 601604, (2016) (PubMed).

    Lin, Huang, Shen, Yiming: "MicroRNA-101 regulates the viability and invasion of cervical cancer cells." in: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10148-55, (2016) (PubMed).

    Shen, Chen, Zhang, Du, Bai, Zhang, Jiang, Li, Wang, Zhu: "MicroRNA-27b Regulates Mitochondria Biogenesis in Myocytes." in: PLoS ONE, Vol. 11, Issue 2, pp. e0148532, (2016) (PubMed).

    Zhao, Zhao, Wang, Li, Zhang: "Glycyrrhizic Acid Attenuates Sepsis-Induced Acute Kidney Injury by Inhibiting NF-κB Signaling Pathway." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2016, pp. 8219287, (2016) (PubMed).

    Zhen, Zong, Gao, Cao, Jiang, Chen, Wang, Sun, Peng, Bai, Li: "Preparation and characterization of a novel aspirin derivative with anti-thrombotic and gastric mucosal protection properties." in: PLoS ONE, Vol. 9, Issue 6, pp. e98513, (2015) (PubMed).

    Wang, Yang, Cui, Chen, Jiang: "Anti-inflammatory and anti-nociceptive activities of methanol extract from aerial part of Phlomis younghusbandii Mukerjee." in: PLoS ONE, Vol. 9, Issue 3, pp. e89149, (2014) (PubMed).

    Cao, Zhang, Xie, Jiang, Ji, Gao: "Chemokine CXCL1 enhances inflammatory pain and increases NMDA receptor activity and COX-2 expression in spinal cord neurons via activation of CXCR2." in: Experimental neurology, Vol. 261, pp. 328-36, (2014) (PubMed).

    Liu, Yan, Li, Yin, Sun, Kou, Ye, Ferns, Liu, Liu: "Reduced expression of SOX7 in ovarian cancer: a novel tumor suppressor through the Wnt/?-catenin signaling pathway." in: Journal of ovarian research, Vol. 7, pp. 87, (2014) (PubMed).

    Yang, Wang, Wang, Xu, He, Wen, Yan, Su, Zhu: "Toll-like receptor 4 prompts human breast cancer cells invasiveness via lipopolysaccharide stimulation and is overexpressed in patients with lymph node metastasis." in: PLoS ONE, Vol. 9, Issue 10, pp. e109980, (2014) (PubMed).

    Duan, Que, Lv, Li, Yin, Zhang: "Tolerance of neurite outgrowth to Rho kinase inhibitors decreased by cyclooxygenase-2 inhibitor." in: Neural regeneration research, Vol. 7, Issue 34, pp. 2705-12, (2014) (PubMed).

    Wang, Du, Wang, Kuang, Wang: "Z-ligustilide attenuates lipopolysaccharide-induced proinflammatory response via inhibiting NF-kappaB pathway in primary rat microglia." in: Acta pharmacologica Sinica, Vol. 31, Issue 7, pp. 791-7, (2010) (PubMed).

  • Target
    PTGS2 (Prostaglandin-Endoperoxide Synthase 2 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS2))
    Alternative Name
    PTGS2 (PTGS2 Products)
    Synonyms
    COX-2 antibody, COX2 antibody, GRIPGHS antibody, PGG/HS antibody, PGHS-2 antibody, PHS-2 antibody, hCox-2 antibody, Cox-2 antibody, Pghs2 antibody, TIS10 antibody, Cox2 antibody, cox-2 antibody, CEF147 antibody, PGHS2 antibody, PHSII antibody, cox2 antibody, gripghs antibody, pgg/hs antibody, pghs-2 antibody, phs-2 antibody, PTGS2 antibody, hcox-2 antibody, fj02a10 antibody, ptgs2 antibody, unp1239 antibody, wu:fj02a10 antibody, zCOX-2 antibody, si:dkey-97o5.6 antibody, prostaglandin-endoperoxide synthase 2 antibody, prostaglandin G/H synthase 2 antibody, prostaglandin-endoperoxide synthase 2S homeolog antibody, prostaglandin-endoperoxide synthase 2a antibody, prostaglandin-endoperoxide synthase 2b antibody, PTGS2 antibody, Ptgs2 antibody, LOC100136456 antibody, ptgs2.S antibody, ptgs2 antibody, ptgs2a antibody, ptgs2b antibody
    Background
    Cyclooxygenase (Cox) is the key enzyme in conversion of arachidonic acid to PGs, and two isoforms, Cox-1 and Cox-2, have been identified. Cox-2 gene encodes an inducible prostaglandin synthase enzyme that is overexpressed in adenocarcinomas and other tumors. Deletion of the murine Cox-2 gene in Min mice reduced the incidence of intestinal tumors, suggesting that it is required for tumorigenesis. This gene is localized to sites associated with retinal blood vessels, and plays an important role in blood vessel formation in the retina. And the glucocorticoid receptor suppression of COX-2 is also crucial for curtailing lethal immune activation, and suggests new therapeutic approaches for regulation of T-cell-mediated inflammatory diseases.

    Synonyms: Prostaglandin G/H synthase 2 | 1.14.99.1 | Cyclooxygenase-2 | COX-2 | PHS II | Prostaglandin H2 synthase 2 | PGH synthase 2 | PGHS-2 | Prostaglandin-endoperoxide synthase 2 | PTGS2 | COX2 | P35354
    Gene ID
    5743
    UniProt
    P35354
    Pathways
    Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation
Support