NR1H4 antibody (C-Term)

Catalog No. ABIN5518940

Product Details anti-NR1H4 Antibody

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Binding Specificity: AA 442-486, C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR1H4 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Bile acid receptor(NR1H4) detection. Tested with WB in Human,Mouse.

Sequence: QHFACLLGRL TELRTFNHHH AEMLMSWRVN DHKFTPLLCE IWDVQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Bile acid receptor(NR1H4) detection. Tested with WB in Human,Mouse.
Gene Name: nuclear receptor subfamily 1 group H member 4
Protein Name: Bile acid receptor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NR1H4 (442-486aa QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for NR1H4

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Alternative Name: NR1H4 (NR1H4 Products)

Synonyms: zgc:110190 antibody, zgc:92742 antibody, NR1H4 antibody, BAR antibody, FXR antibody, HRR-1 antibody, HRR1 antibody, RIP14 antibody, AI957360 antibody, Fxr antibody, Rxrip14 antibody, nuclear receptor subfamily 1, group H, member 5 S homeolog antibody, nuclear receptor subfamily 1, group H, member 4 antibody, nuclear receptor subfamily 1 group H member 4 antibody, nr1h5.S antibody, nr1h4 antibody, NR1H4 antibody, Nr1h4 antibody

Background: The bile acid receptor (BAR), also known as farnesoid X receptor (FXR) or NR1H4 (nuclear receptor subfamily 1, group H, member 4) is a nuclear receptor that is encoded by the NR1H4 gene in humans. This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport.

Synonyms: Bile acid receptor, Farnesoid X-activated receptor, Farnesol receptor HRR-1, Nuclear receptor subfamily 1 group H member 4, Retinoid X receptor-interacting protein 14, RXR-interacting protein 14, NR1H4, BAR, FXR, HRR1, RIP14

Gene ID: 9971

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Carbohydrate Metabolic Process