RGS17 antibody (Regulator of G-Protein Signaling 17) (AA 111-210) Primary Antibody
RGS17
Reactivity: Human
ELISA, WB
Host: Mouse
Polyclonal
camera_alt 1
Catalog No. ABIN565286
$305.71
Plus shipping costs $45.00
50 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 111-210
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Polyclonal
- Conjugate
- This RGS17 antibody is un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse polyclonal antibody raised against a partial recombinant RGS17.
- Cross-Reactivity
- Human
- Immunogen
immunogen: RGS17 (NP_036551, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Immunogen Sequence: LLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- 50 % glycerol
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- RGS17 (RGS17 Antibody Abstract)
- Background
- Full Gene Name: regulator of G-protein signaling 17
Synonyms: RGS-17,RGSZ2,hRGS17 - Gene ID
- 26575
- NCBI Accession
- NP_036551, NM_012419
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
You are here: