STAR antibody

Catalog No. ABIN5693042

Product Details anti-STAR Antibody

Target: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAR antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: EETLYSDQEL AYLQQGEEAM QKALGILSNQ EGWKKESQQD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for StAR detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human StAR (EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for STAR

Target: STAR (Steroidogenic Acute Regulatory Protein (STAR))

Alternative Name: STAR (STAR Products)

Synonyms: STARD1 antibody, AV363654 antibody, D8Ertd419e antibody, star antibody, LOC100219165 antibody, StARD1 antibody, steroidogenic acute regulatory protein antibody, steroidogenic acute regulatory protein L homeolog antibody, STAR antibody, Star antibody, star antibody, star.L antibody

Background:

Synonyms: Steroidogenic acute regulatory protein, mitochondrial, StAR, START domain-containing protein 1, StARD1, STAR, STARD1

Tissue Specificity: Expressed in gonads, adrenal cortex and kidney.

Background: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.

UniProt: P49675

Pathways: Metabolism of Steroid Hormones and Vitamin D, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis