Angiotensin I Converting Enzyme 1 antibody
-
- Target See all Angiotensin I Converting Enzyme 1 (ACE) Antibodies
- Angiotensin I Converting Enzyme 1 (ACE) (Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 1 (ACE))
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Angiotensin I Converting Enzyme 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Brand
- Picoband™
- Sequence
- AMMNYFKPLT EWLVTENRRH GETLGWPEYN WAPNTAR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for Ace detection. Tested with WB in Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).
- Top Product
- Discover our top product ACE Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 3965-3973, (2018) (PubMed).
: "
-
Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 3965-3973, (2018) (PubMed).
-
- Target
- Angiotensin I Converting Enzyme 1 (ACE) (Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 1 (ACE))
- Alternative Name
- Ace (ACE Products)
- Synonyms
- ACE1 antibody, CD143 antibody, DCP antibody, DCP1 antibody, ICH antibody, MVCD3 antibody, AW208573 antibody, Dcp1 antibody, StsRR92 antibody, dcp antibody, ace1 antibody, dcp1 antibody, xace antibody, cd143 antibody, ACE antibody, angiotensin I converting enzyme antibody, angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 antibody, angiotensin-converting enzyme antibody, angiotensin I converting enzyme (peptidyl-dipeptidase A) 3 antibody, angiotensin-converting enzyme-like antibody, ACE antibody, Ace antibody, ace antibody, CpipJ_CPIJ009106 antibody, ACE3 antibody, LOC101824864 antibody
- Background
-
Synonyms: Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, Angiotensin-converting enzyme, soluble form, Ace, Dcp1
Tissue Specificity: Testis-specific isoform is expressed in spermatocytes, adult testis.
Background: Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.
- UniProt
- P09470
- Pathways
- ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour, Smooth Muscle Cell Migration
-