FZD4 antibody

Catalog No. ABIN5708436

Product Details anti-FZD4 Antibody

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY from the human protein were used as the immunogen for the FZD4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FZD4 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FZD4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FZD4

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Alternative Name: Frizzled 4 / FZD4 (FZD4 Products)

Synonyms: CG4626 antibody, DFz4 antibody, Dfz4 antibody, Dm Fz4 antibody, Dmel\\CG4626 antibody, Fz4 antibody, anon-WO0170980.10 antibody, anon-WO0170980.11 antibody, fz1 antibody, zg01 antibody, CD344 antibody, EVR1 antibody, FEVR antibody, FZD4S antibody, Fz-4 antibody, FzE4 antibody, GPCR antibody, hFz4 antibody, frizzled4 antibody, fz4 antibody, FZ-4 antibody, frizzled 4 antibody, frizzled class receptor 4 antibody, frizzled-4 antibody, frizzled class receptor 4 S homeolog antibody, fz4 antibody, fzd4 antibody, Tsp_10376 antibody, FZD4 antibody, Fzd4 antibody, fzd4.S antibody

Background: Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

UniProt: Q9ULV1

Pathways: WNT Signaling, Hormone Transport, Sensory Perception of Sound