NPC2 antibody

Catalog No. ABIN5708461

Product Details anti-NPC2 Antibody

Target: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPC2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS from the human protein were used as the immunogen for the NPC2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the NPC2 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the NPC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NPC2

Target: NPC2 (Niemann-Pick Disease, Type C2 (NPC2))

Alternative Name: NPC2 / Niemann Pick C2 (NPC2 Products)

Synonyms: 2700012J19Rik antibody, AA408070 antibody, AU045843 antibody, HE1 antibody, EDDM1 antibody, re1 antibody, CE1 antibody, EPI-1 antibody, cb292 antibody, sb:cb292 antibody, NPC intracellular cholesterol transporter 2 antibody, Niemann-Pick disease, type C2 antibody, Npc2 antibody, NPC2 antibody, npc2 antibody

Background: NPC2 is a protein associated with Niemann-Pick disease, type C. This gene is mapped to chromosome 14q24.3. It encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.

UniProt: P61916

Pathways: SARS-CoV-2 Protein Interactome