MDH2 antibody
-
- Target See all MDH2 Antibodies
- MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MDH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK
- Top Product
- Discover our top product MDH2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MDH2 Blocking Peptide, catalog no. 33R-9388, is also available for use as a blocking control in assays to test for specificity of this MDH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))
- Alternative Name
- MDH2 (MDH2 Products)
- Synonyms
- Mdh2b antibody, m-mdh antibody, mdh2 antibody, mor1 antibody, MDH-2 antibody, Mdh antibody, wu:fj48c08 antibody, wu:fj55d06 antibody, zgc:64133 antibody, M-MDH antibody, MDH antibody, MGC:3559 antibody, MOR1 antibody, MMDH antibody, Mdh-2 antibody, Mor-1 antibody, Mor1 antibody, malate dehydrogenase 2 S homeolog antibody, malate dehydrogenase 2 antibody, Malate dehydrogenase 2 antibody, malate dehydrogenase antibody, malate dehydrogenase 2, NAD (mitochondrial) antibody, mdh2.S antibody, MDH2 antibody, Mdh2 antibody, MDH4 antibody, mdh2 antibody
- Background
- Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle.
- Molecular Weight
- 33 kDa (MW of target protein)
-