FDFT1 antibody (N-Term)
-
- Target See all FDFT1 Antibodies
- FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FDFT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FDFT1 antibody was raised against the N terminal of FDFT1
- Purification
- Purified
- Immunogen
- FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM
- Top Product
- Discover our top product FDFT1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FDFT1 Blocking Peptide, catalog no. 33R-3852, is also available for use as a blocking control in assays to test for specificity of this FDFT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDFT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))
- Alternative Name
- FDFT1 (FDFT1 Products)
- Synonyms
- FDFT1 antibody, DKFZp459C1712 antibody, SQS antibody, SS antibody, DGPT antibody, ERG9 antibody, fdft1 antibody, farnesyl-diphosphate farnesyltransferase 1 antibody, squalene synthase antibody, farnesyl diphosphate farnesyl transferase 1 antibody, FDFT1 antibody, fdft1 antibody, LOC100560926 antibody, Fdft1 antibody
- Background
- FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-