XRCC5 antibody
-
- Target See all XRCC5 Antibodies
- XRCC5 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-Strand-Break Rejoining) (XRCC5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XRCC5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- XRCC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
- Top Product
- Discover our top product XRCC5 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XRCC5 Blocking Peptide, catalog no. 33R-3345, is also available for use as a blocking control in assays to test for specificity of this XRCC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRCC5 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-Strand-Break Rejoining) (XRCC5))
- Alternative Name
- XRCC5 (XRCC5 Products)
- Synonyms
- AI314015 antibody, Ku80 antibody, Ku86 antibody, Kup80 antibody, KARP-1 antibody, KARP1 antibody, KU80 antibody, KUB2 antibody, NFIV antibody, xrcc5-a antibody, XRCC5 antibody, X-ray repair cross complementing 5 antibody, X-ray repair complementing defective repair in Chinese hamster cells 5 antibody, X-ray repair complementing defective repair in Chinese hamster cells 5 L homeolog antibody, XRCC5 antibody, Xrcc5 antibody, xrcc5.L antibody
- Background
- XRCC5 encodes the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
- Molecular Weight
- 83 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-