SERPINB5 antibody

Catalog No. ABIN629846

Product Details anti-SERPINB5 Antibody

Target: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPINB5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Application Details

Application Notes: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINB5 Blocking Peptide, catalog no. 33R-6892, is also available for use as a blocking control in assays to test for specificity of this SERPINB5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPINB5

Target: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Alternative Name: SERPINB5 (SERPINB5 Products)

Synonyms: 1110036M19Rik antibody, AI462524 antibody, AI646751 antibody, Maspin antibody, PI-5 antibody, Spi7 antibody, ovalbumin antibody, PI5 antibody, maspin antibody, Pi5 antibody, serine (or cysteine) peptidase inhibitor, clade B, member 5 antibody, serpin family B member 5 antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 5 S homeolog antibody, Serpinb5 antibody, SERPINB5 antibody, serpinb5.S antibody

Background: As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: p53 Signaling