SLC7A8 antibody

Catalog No. ABIN630365

Product Details anti-SLC7A8 Antibody

Target: SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC7A8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SLC7 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC7A8 Blocking Peptide, catalog no. 33R-7317, is also available for use as a blocking control in assays to test for specificity of this SLC7A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC7A8

Target: SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))

Alternative Name: SLC7A8 (SLC7A8 Products)

Synonyms: LAT2 antibody, LPI-PC1 antibody, Lat2 antibody, Lat4 antibody, XAA2 antibody, lat2 antibody, lpi-pc1 antibody, 4F2LC-5 antibody, AA408822 antibody, si:ch211-14a17.3 antibody, si:zc14a17.3 antibody, slc7a8 antibody, solute carrier family 7 member 8 antibody, solute carrier family 7 member 8 L homeolog antibody, solute carrier family 7 (amino acid transporter, L-type), member 8 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 antibody, solute carrier family 7 (amino acid transporter light chain, L system), member 8b antibody, SLC7A8 antibody, Slc7a8 antibody, slc7a8.L antibody, slc7a8 antibody, slc7a8b antibody

Background: SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.

Molecular Weight: 37 kDa (MW of target protein)