Retinoic Acid Receptor beta antibody (C-Term)
-
- Target See all Retinoic Acid Receptor beta (RARB) Antibodies
- Retinoic Acid Receptor beta (RARB) (Retinoic Acid Receptor, beta (RARB))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Retinoic Acid Receptor beta antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RARB antibody was raised against the C terminal of RARB
- Purification
- Affinity purified
- Immunogen
- RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS
- Top Product
- Discover our top product RARB Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RARB Blocking Peptide, catalog no. 33R-8298, is also available for use as a blocking control in assays to test for specificity of this RARB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoic Acid Receptor beta (RARB) (Retinoic Acid Receptor, beta (RARB))
- Alternative Name
- RARB (RARB Products)
- Synonyms
- RARB antibody, nRARs antibody, HAP antibody, NR1B2 antibody, RRB2 antibody, A830025K23 antibody, Hap antibody, Nr1b2 antibody, RARbeta2 antibody, RARBETA antibody, retinoic acid receptor beta antibody, retinoic acid receptor, beta antibody, RARB antibody, Rarb antibody
- Background
- RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-