NR1H4 antibody (Middle Region)

Catalog No. ABIN630514

Product Details anti-NR1H4 Antibody

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR1H4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR1 H4 antibody was raised against the middle region of NR1 4

Purification: Affinity purified

Immunogen: NR1 H4 antibody was raised using the middle region of NR1 4 corresponding to a region with amino acids SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR1H4 Blocking Peptide, catalog no. 33R-8322, is also available for use as a blocking control in assays to test for specificity of this NR1H4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR1H4

Target: NR1H4 (Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4))

Alternative Name: NR1H4 (NR1H4 Products)

Synonyms: zgc:110190 antibody, zgc:92742 antibody, NR1H4 antibody, BAR antibody, FXR antibody, HRR-1 antibody, HRR1 antibody, RIP14 antibody, AI957360 antibody, Fxr antibody, Rxrip14 antibody, nuclear receptor subfamily 1, group H, member 5 S homeolog antibody, nuclear receptor subfamily 1, group H, member 4 antibody, nuclear receptor subfamily 1 group H member 4 antibody, nr1h5.S antibody, nr1h4 antibody, NR1H4 antibody, Nr1h4 antibody

Background: NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Carbohydrate Metabolic Process