PPP2R5C antibody (Middle Region)

Catalog No. ABIN630610

Product Details anti-PPP2R5C Antibody

Target: PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP2R5C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PPP2 R2 antibody was raised against the middle region of PPP2 2

Purification: Affinity purified

Immunogen: PPP2 R2 antibody was raised using the middle region of PPP2 2 corresponding to a region with amino acids RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP2R5C Blocking Peptide, catalog no. 33R-7903, is also available for use as a blocking control in assays to test for specificity of this PPP2R5C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP2R5C

Target: PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))

Alternative Name: PPP2R5C (PPP2R5C Products)

Synonyms: B56G antibody, PR61G antibody, 2610043M05Rik antibody, 2700063L20Rik antibody, AI060890 antibody, AW545884 antibody, C85228 antibody, D12Bwg0916e antibody, mKIAA0044 antibody, b56g antibody, ppp2r5c antibody, si:dkey-241l7.9 antibody, protein phosphatase 2 regulatory subunit B'gamma antibody, protein phosphatase 2, regulatory subunit B', gamma antibody, protein phosphatase 2 regulatory subunit B', gamma antibody, protein phosphatase 2, regulatory subunit B', gamma b antibody, protein phosphatase 2, regulatory subunit B', gamma a antibody, PPP2R5C antibody, Ppp2r5c antibody, ppp2r5c antibody, ppp2r5c.L antibody, ppp2r5cb antibody, ppp2r5ca antibody

Background: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

Molecular Weight: 45 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling