WDR77 antibody (N-Term)

Catalog No. ABIN630615

Product Details anti-WDR77 Antibody

Target: WDR77 (WD Repeat Domain 77 (WDR77))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR77 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR77 antibody was raised against the N terminal of WDR77

Purification: Affinity purified

Immunogen: WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR77 Blocking Peptide, catalog no. 33R-6364, is also available for use as a blocking control in assays to test for specificity of this WDR77 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR77 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR77

Target: WDR77 (WD Repeat Domain 77 (WDR77))

Alternative Name: WDR77 (WDR77 Products)

Synonyms: MEP-50 antibody, MEP50 antibody, Nbla10071 antibody, RP11-552M11.3 antibody, p44 antibody, p44/Mep50 antibody, 2610003I18Rik antibody, 2610312E17Rik antibody, C79984 antibody, p44/MEP50 antibody, RGD1310479 antibody, mep50 antibody, valois antibody, WDR77 antibody, zgc:65780 antibody, zgc:77274 antibody, WD repeat domain 77 antibody, WD repeat domain 77 S homeolog antibody, WDR77 antibody, Wdr77 antibody, wdr77.S antibody, wdr77 antibody

Background: WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization