PRMT2 antibody (N-Term)
-
- Target See all PRMT2 Antibodies
- PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRMT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRMT2 antibody was raised against the N terminal of PRMT2
- Purification
- Affinity purified
- Immunogen
- PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
- Top Product
- Discover our top product PRMT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRMT2 Blocking Peptide, catalog no. 33R-2686, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))
- Alternative Name
- PRMT2 (PRMT2 Products)
- Synonyms
- PRMT2 antibody, DKFZp459N1919 antibody, HRMT1L1 antibody, Hrmt1l1 antibody, AI504737 antibody, protein arginine methyltransferase 2 antibody, protein arginine methyltransferase 2 L homeolog antibody, protein arginine N-methyltransferase 2 antibody, PRMT2 antibody, Prmt2 antibody, prmt2.L antibody
- Background
- The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding
-