TTC5 antibody (C-Term)
-
- Target See all TTC5 Antibodies
- TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TTC5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TTC5 antibody was raised against the C terminal of TTC5
- Purification
- Affinity purified
- Immunogen
- TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV
- Top Product
- Discover our top product TTC5 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TTC5 Blocking Peptide, catalog no. 33R-3213, is also available for use as a blocking control in assays to test for specificity of this TTC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC5 (Tetratricopeptide Repeat Domain 5 (TTC5))
- Alternative Name
- TTC5 (TTC5 Products)
- Synonyms
- TTC5 antibody, ttc5 antibody, wu:fi33h05 antibody, wu:fy81e07 antibody, zgc:112059 antibody, Strap antibody, 5930437N14 antibody, AW743060 antibody, tetratricopeptide repeat domain 5 L homeolog antibody, tetratricopeptide repeat domain 5 antibody, ttc5.L antibody, TTC5 antibody, ttc5 antibody, Ttc5 antibody
- Background
- TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-