POLR3H antibody (Middle Region)
-
- Target See all POLR3H Antibodies
- POLR3H (Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLR3H antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- POLR3 H antibody was raised against the middle region of POLR3
- Purification
- Affinity purified
- Immunogen
- POLR3 H antibody was raised using the middle region of POLR3 corresponding to a region with amino acids AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL
- Top Product
- Discover our top product POLR3H Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLR3H Blocking Peptide, catalog no. 33R-1242, is also available for use as a blocking control in assays to test for specificity of this POLR3H antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR3H (Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H))
- Alternative Name
- POLR3H (POLR3H Products)
- Synonyms
- 5031409G22Rik antibody, RPC8 antibody, RPC22.9 antibody, polymerase (RNA) III (DNA directed) polypeptide H antibody, RNA polymerase III subunit H antibody, Polr3h antibody, POLR3H antibody
- Background
- POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.
- Molecular Weight
- 20 kDa (MW of target protein)
-