PPP2R1A antibody
-
- Target See all PPP2R1A Antibodies
- PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP2R1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
- Top Product
- Discover our top product PPP2R1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP2R1A Blocking Peptide, catalog no. 33R-6908, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
- Alternative Name
- PPP2R1A (PPP2R1A Products)
- Synonyms
- PP2A-Aalpha antibody, PP2AAALPHA antibody, PR65A antibody, PR65 antibody, pp2a-aalpha antibody, pp2aaalpha antibody, ppp2r1a antibody, pr65a antibody, wu:fa02h04 antibody, zgc:56296 antibody, 6330556D22Rik antibody, PP2A antibody, ppp2r1a-a antibody, ppp2r1a-b antibody, protein phosphatase 2 scaffold subunit Aalpha antibody, protein phosphatase 2 scaffold subunit A alpha antibody, protein phosphatase 2 regulatory subunit A, alpha L homeolog antibody, protein phosphatase 2 regulatory subunit A, alpha antibody, protein phosphatase 2, regulatory subunit A, beta a antibody, serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform antibody, protein phosphatase 2, regulatory subunit A, alpha isoform antibody, protein phosphatase 2, regulatory subunit A, alpha antibody, protein phosphatase 2 regulatory subunit A, alpha S homeolog antibody, PPP2R1A antibody, Ppp2r1a antibody, ppp2r1a.L antibody, ppp2r1a antibody, ppp2r1ba antibody, LOC583227 antibody, ppp2r1a.S antibody
- Background
- PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signaling, Mitotic G1-G1/S Phases, M Phase, Hepatitis C, Toll-Like Receptors Cascades
-