PPP2R3A antibody
-
- Target See all PPP2R3A Antibodies
- PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP2R3A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
- Top Product
- Discover our top product PPP2R3A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP2R3A Blocking Peptide, catalog no. 33R-8853, is also available for use as a blocking control in assays to test for specificity of this PPP2R3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R3A (Protein Phosphatase 2, Regulatory Subunit B'', alpha (PPP2R3A))
- Alternative Name
- PPP2R3A (PPP2R3A Products)
- Synonyms
- PPP2R3 antibody, PR130 antibody, PR72 antibody, 3222402P14Rik antibody, A730042E07 antibody, PPP2R3A antibody, Ppp2r3a antibody, protein phosphatase 2 regulatory subunit B''alpha antibody, protein phosphatase 2, regulatory subunit B'', alpha antibody, protein phosphatase 2 regulatory subunit B, alpha S homeolog antibody, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha antibody, PPP2R3A antibody, Ppp2r3a antibody, ppp2r3a.S antibody, LOC100088744 antibody, LOC100478108 antibody, ppp2r3a antibody, LOC100547843 antibody, LOC100729010 antibody
- Background
- Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division.
- Molecular Weight
- 130 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signaling
-