PSMB5 antibody

Catalog No. ABIN630923

Product Details anti-PSMB5 Antibody

Target: PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMB5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMB5 Blocking Peptide, catalog no. 33R-4193, is also available for use as a blocking control in assays to test for specificity of this PSMB5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMB5

Target: PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))

Alternative Name: PSMB5 (PSMB5 Products)

Synonyms: LMPX antibody, MB1 antibody, X antibody, etID309919.2 antibody, fb59c07 antibody, si:zc14a17.13 antibody, wu:fb59c07 antibody, x antibody, zgc:86820 antibody, proteasome subunit beta 5 antibody, proteasome (prosome, macropain) subunit, beta type 5 antibody, proteasome subunit beta 5 L homeolog antibody, proteasome (prosome, macropain) subunit, beta type, 5 antibody, PSMB5 antibody, psmb5 antibody, Psmb5 antibody, psmb5.L antibody

Background: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB5 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA