PDK3 antibody (Middle Region)
-
- Target See all PDK3 Antibodies
- PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDK3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PDK3 antibody was raised against the middle region of PDK3
- Purification
- Affinity purified
- Immunogen
- PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK
- Top Product
- Discover our top product PDK3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDK3 Blocking Peptide, catalog no. 33R-4222, is also available for use as a blocking control in assays to test for specificity of this PDK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))
- Alternative Name
- PDK3 (PDK3 Products)
- Synonyms
- pdk3 antibody, PDK3 antibody, 2610001M10Rik antibody, AI035637 antibody, zgc:158702 antibody, pyruvate dehydrogenase kinase 3 antibody, pyruvate dehydrogenase kinase, isozyme 3a antibody, pyruvate dehydrogenase kinase, isoenzyme 3 antibody, fragile site, 5-azacytidine type, common, fra(1)(q12) antibody, pyruvate dehydrogenase kinase, isozyme 3b antibody, PDK3 antibody, Pdk3 antibody, pdk3a antibody, pdk3 antibody, FRA1J antibody, pdk3b antibody
- Background
- PDK3 belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect
-