MMADHC antibody (Middle Region)
-
- Target See all MMADHC Antibodies
- MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMADHC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C2 ORF25 antibody was raised against the middle region of C2 rf25
- Purification
- Affinity purified
- Immunogen
- C2 ORF25 antibody was raised using the middle region of C2 rf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI
- Top Product
- Discover our top product MMADHC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C2ORF25 Blocking Peptide, catalog no. 33R-7803, is also available for use as a blocking control in assays to test for specificity of this C2ORF25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))
- Alternative Name
- C2ORF25 (MMADHC Products)
- Synonyms
- C2orf25 antibody, CL25022 antibody, cblD antibody, 2010311D03Rik antibody, AI314967 antibody, RGD1303272 antibody, methylmalonic aciduria and homocystinuria, cblD type antibody, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria antibody, MMADHC antibody, Mmadhc antibody
- Background
- Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.
- Molecular Weight
- 33 kDa (MW of target protein)
-