IDH2 antibody
-
- Target See all IDH2 Antibodies
- IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IDH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK
- Top Product
- Discover our top product IDH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IDH2 Blocking Peptide, catalog no. 33R-3304, is also available for use as a blocking control in assays to test for specificity of this IDH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))
- Alternative Name
- IDH2 (IDH2 Products)
- Synonyms
- F6P23.14 antibody, F6P23_14 antibody, IDH-II antibody, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 2 antibody, isocitrate dehydrogenase II antibody, isocitrate dehydrogenase subunit 2 antibody, D2HGA2 antibody, ICD-M antibody, IDH antibody, IDHM antibody, IDP antibody, IDPM antibody, mNADP-IDH antibody, E430004F23 antibody, IDPm antibody, Idh-2 antibody, wu:fb33c06 antibody, wu:fk31e05 antibody, wu:fq43b01 antibody, zgc:55485 antibody, idh2 antibody, IDH2 antibody, isocitrate dehydrogenase subunit 2 antibody, isocitrate dehydrogenase (NADP(+)) 2, mitochondrial antibody, isocitrate dehydrogenase 2 (NADP+), mitochondrial antibody, isocitrate dehydrogenase 2 (NADP+), mitochondrial S homeolog antibody, isocitrate dehydrogenase [NADP], mitochondrial antibody, IDH2 antibody, Idh2 antibody, idh2.S antibody, idh2 antibody, LOC100441867 antibody
- Background
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Warburg Effect
-