SHC3 antibody
-
- Target See all SHC3 Antibodies
- SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SHC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SHC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST
- Top Product
- Discover our top product SHC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SHC3 Blocking Peptide, catalog no. 33R-8036, is also available for use as a blocking control in assays to test for specificity of this SHC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))
- Alternative Name
- SHC3 (SHC3 Products)
- Synonyms
- N-Shc antibody, NSHC antibody, RAI antibody, SHCC antibody, ShcC antibody, Rai antibody, SHC adaptor protein 3 antibody, src homology 2 domain-containing transforming protein C3 antibody, SHC3 antibody, Shc3 antibody
- Background
- SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.
- Molecular Weight
- 64 kDa (MW of target protein)
- Pathways
- RTK Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway
-