PARD6A antibody

Catalog No. ABIN631173

Product Details anti-PARD6A Antibody

Target: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARD6A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PARD6 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARD6A Blocking Peptide, catalog no. 33R-5734, is also available for use as a blocking control in assays to test for specificity of this PARD6A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARD6A

Target: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Alternative Name: PARD6A (PARD6A Products)

Synonyms: PARD6A antibody, 0710008C04Rik antibody, 2610010A15Rik antibody, PAR6alpha antibody, Par-6 antibody, Par6 antibody, Par6c antibody, TAX40 antibody, Tip-40 antibody, Par-6a antibody, Par6a antibody, PAR-6A antibody, PAR6 antibody, PAR6C antibody, TIP-40 antibody, par-6 partitioning defective 6 homolog alpha (C. elegans) antibody, par-6 family cell polarity regulator alpha antibody, Partitioning defective protein 6 antibody, PARD6A antibody, Pard6a antibody, par-6 antibody

Background: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization