PPM1B antibody
-
- Target See all PPM1B Antibodies
- PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPM1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPM1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN
- Top Product
- Discover our top product PPM1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPM1B Blocking Peptide, catalog no. 33R-2480, is also available for use as a blocking control in assays to test for specificity of this PPM1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPM1B (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1B (PPM1B))
- Alternative Name
- PPM1B (PPM1B Products)
- Synonyms
- PP2C-beta-X antibody, PP2CB antibody, PP2CBETA antibody, PPC2BETAX antibody, Pp2c2 antibody, fc18g04 antibody, ppm1a antibody, wu:fc18g04 antibody, zgc:92329 antibody, pp2c-beta-x antibody, pp2cb antibody, pp2cbeta antibody, ppc2betax antibody, zgc:92031 antibody, protein phosphatase, Mg2+/Mn2+ dependent 1B antibody, protein phosphatase 1B, magnesium dependent, beta isoform antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1B antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1Bb antibody, protein phosphatase, Mg2+/Mn2+ dependent 1B L homeolog antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1Ba antibody, PPM1B antibody, Ppm1b antibody, ppm1bb antibody, ppm1b.L antibody, ppm1ba antibody
- Background
- The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent
- Molecular Weight
- 21 kDa (MW of target protein)
-