MAP2K3 antibody (C-Term)

Catalog No. ABIN631258

Product Details anti-MAP2K3 Antibody

Target: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP2K3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP2 K3 antibody was raised against the C terminal of MAP2 3

Purification: Affinity purified

Immunogen: MAP2 K3 antibody was raised using the C terminal of MAP2 3 corresponding to a region with amino acids EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP2K3 Blocking Peptide, catalog no. 33R-2380, is also available for use as a blocking control in assays to test for specificity of this MAP2K3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP2K3

Target: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Alternative Name: MAP2K3 (MAP2K3 Products)

Synonyms: MAPKK3 antibody, MEK3 antibody, MKK3 antibody, PRKMK3 antibody, SAPKK-2 antibody, SAPKK2 antibody, AW212142 antibody, Prkmk3 antibody, mMKK3b antibody, Mkk3 antibody, mitogen-activated protein kinase kinase 3 antibody, mitogen activated protein kinase kinase 3 antibody, MAP kinase activator XMEK3 antibody, MAP2K3 antibody, Map2k3 antibody, map2k3 antibody

Background: MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: MAPK Signaling, TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2