NLRP1 antibody (N-Term)

Catalog No. ABIN631304

Product Details anti-NLRP1 Antibody

Target: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NLRP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NLRP1 antibody was raised against the N terminal of NLRP1

Purification: Affinity purified

Immunogen: NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NLRP1 Blocking Peptide, catalog no. 33R-2204, is also available for use as a blocking control in assays to test for specificity of this NLRP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLRP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NLRP1

Target: NLRP1 (NLR Family, Pyrin Domain Containing 1 (NLRP1))

Alternative Name: NLRP1 (NLRP1 Products)

Synonyms: CARD7 antibody, CIDED antibody, CLR17.1 antibody, DEFCAP antibody, DEFCAP-L/S antibody, NAC antibody, NALP1 antibody, PP1044 antibody, SLEV1 antibody, VAMAS1 antibody, NLR family pyrin domain containing 1 antibody, NLRP1 antibody, Nlrp1 antibody

Background: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death.

Molecular Weight: 155 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Inflammasome