UBE2L6 antibody (N-Term)
-
- Target See all UBE2L6 Antibodies
- UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2L6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UBE2 L6 antibody was raised against the N terminal of UBE2 6
- Purification
- Affinity purified
- Immunogen
- UBE2 L6 antibody was raised using the N terminal of UBE2 6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL
- Top Product
- Discover our top product UBE2L6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UBE2L6 Blocking Peptide, catalog no. 33R-5160, is also available for use as a blocking control in assays to test for specificity of this UBE2L6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))
- Alternative Name
- UBE2L6 (UBE2L6 Products)
- Synonyms
- UBE2L6 antibody, RIG-B antibody, UBCH8 antibody, 2810489I21Rik antibody, Ubce8 antibody, Ubcm8 antibody, UbcM8 antibody, ubiquitin conjugating enzyme E2 L6 antibody, ubiquitin-conjugating enzyme E2L 6 antibody, UBE2L6 antibody, Ube2l6 antibody
- Background
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene.
- Molecular Weight
- 18 kDa (MW of target protein)
-