ATP6V1B1 antibody (Middle Region)
-
- Target See all ATP6V1B1 Antibodies
- ATP6V1B1 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B1 (ATP6V1B1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP6V1B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP6 V6 1 antibody was raised against the middle region of ATP6 6 1
- Purification
- Affinity purified
- Immunogen
- ATP6 V6 1 antibody was raised using the middle region of ATP6 6 1 corresponding to a region with amino acids LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL
- Top Product
- Discover our top product ATP6V1B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP6V1B1 Blocking Peptide, catalog no. 33R-5204, is also available for use as a blocking control in assays to test for specificity of this ATP6V1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6V1B1 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B1 (ATP6V1B1))
- Alternative Name
- ATP6V1B1 (ATP6V1B1 Products)
- Synonyms
- ATP6B1 antibody, RTA1B antibody, VATB antibody, VMA2 antibody, VPP3 antibody, AW208839 antibody, Atp6b1 antibody, D630003L15 antibody, D630030L16Rik antibody, D630039P21Rik antibody, Vpp-3 antibody, Vpp3 antibody, ATPase H+ transporting V1 subunit B1 antibody, ATPase, H+ transporting, lysosomal V1 subunit B1 antibody, ATP6V1B1 antibody, Atp6v1b1 antibody
- Background
- This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis, Proton Transport
-