HSD17B1 antibody

Catalog No. ABIN631774

Product Details anti-HSD17B1 Antibody

Target: HSD17B1 (Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD17B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: HSD17 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD17B1 Blocking Peptide, catalog no. 33R-5737, is also available for use as a blocking control in assays to test for specificity of this HSD17B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD17B1

Target: HSD17B1 (Hydroxysteroid (17-Beta) Dehydrogenase 1 (HSD17B1))

Alternative Name: HSD17B1 (HSD17B1 Products)

Synonyms: EDH17B2 antibody, EDHB17 antibody, HSD17 antibody, SDR28C1 antibody, 17HSDB1 antibody, 17beta-HSD antibody, E2DH antibody, Hsd17ba antibody, 17BHD1 antibody, zfHSD17B1 antibody, hydroxysteroid 17-beta dehydrogenase 1 antibody, hydroxysteroid (17-beta) dehydrogenase 1 antibody, HSD17B1 antibody, Hsd17b1 antibody, hsd17b1 antibody

Background: HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis