Nodal antibody

Catalog No. ABIN631796

Product Details anti-Nodal Antibody

Target: Nodal (NODAL) (Nodal Homolog (NODAL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nodal antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NODAL Blocking Peptide, catalog no. 33R-7373, is also available for use as a blocking control in assays to test for specificity of this NODAL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NODAL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nodal

Target: Nodal (NODAL) (Nodal Homolog (NODAL))

Alternative Name: NODAL (NODAL Products)

Synonyms: NODAL antibody, Tg.413d antibody, HTX5 antibody, nodal4 antibody, nodal4-A antibody, nr4 antibody, xnr4 antibody, Xnr-1 antibody, nodal antibody, nr1 antibody, nr1-A antibody, nodal growth differentiation factor antibody, nodal homolog (mouse) antibody, nodal antibody, nodal growth differentiation factor L homeolog antibody, nodal homolog 1 L homeolog antibody, Nodal antibody, NODAL antibody, nodal.L antibody, nodal1.L antibody

Background: The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Stem Cell Maintenance, Tube Formation, Positive Regulation of Endopeptidase Activity