ERCC6L antibody (N-Term)

Catalog No. ABIN631814

The Rabbit Polyclonal anti-ERCC6L antibody has been validated for WB. It is suitable to detect ERCC6L in samples from Human.

Quick Overview for ERCC6L antibody (N-Term) (ABIN631814)

Target: ERCC6L (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6-Like (ERCC6L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERCC6L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERCC6L Antibody

Binding Specificity: N-Term

Specificity: ERCC6 L antibody was raised against the N terminal Of Ercc6

Purification: Affinity purified

Immunogen: ERCC6 L antibody was raised using the N terminal Of Ercc6 corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERCC6L Blocking Peptide, (ABIN938588), is also available for use as a blocking control in assays to test for specificity of this ERCC6L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERCC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERCC6L

Target: ERCC6L (Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6-Like (ERCC6L))

Alternative Name: ERCC6L

Background: ERCC6L is a DNA helicase that acts as an essential component of the spindle assembly checkpoint.ERCC6L contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. ERCC6L acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.

Molecular Weight: 141 kDa (MW of target protein)