FANCA antibody (N-Term)
-
- Target See all FANCA Antibodies
- FANCA (Fanconi Anemia Group A Protein (FANCA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FANCA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FANCA antibody was raised against the N terminal of FANCA
- Purification
- Affinity purified
- Immunogen
- FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS
- Top Product
- Discover our top product FANCA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FANCA Blocking Peptide, catalog no. 33R-4540, is also available for use as a blocking control in assays to test for specificity of this FANCA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FANCA (Fanconi Anemia Group A Protein (FANCA))
- Alternative Name
- FANCA (FANCA Products)
- Synonyms
- FA antibody, FA-H antibody, FA1 antibody, FAA antibody, FACA antibody, FAH antibody, FANCH antibody, AW208693 antibody, Fanconi anemia complementation group A antibody, Fanconi anemia, complementation group A antibody, FANCA antibody, Fanca antibody
- Background
- The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-