FANCA antibody (N-Term)

Catalog No. ABIN631910

The Rabbit Polyclonal anti-FANCA antibody is suitable to detect FANCA in samples from Human. It has been validated for WB.

Quick Overview for FANCA antibody (N-Term) (ABIN631910)

Target: FANCA (Fanconi Anemia Group A Protein (FANCA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FANCA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FANCA Antibody

Binding Specificity: N-Term

Specificity: FANCA antibody was raised against the N terminal of FANCA

Purification: Affinity purified

Immunogen: FANCA antibody was raised using the N terminal of FANCA corresponding to a region with amino acids KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FANCA Blocking Peptide, (ABIN939926), is also available for use as a blocking control in assays to test for specificity of this FANCA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FANCA

Target: FANCA (Fanconi Anemia Group A Protein (FANCA))

Alternative Name: FANCA

Background: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: DNA Damage Repair