ERP44 antibody

Catalog No. ABIN632154

This anti-ERP44 antibody is a Rabbit Polyclonal antibody detecting ERP44 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ERP44 antibody (ABIN632154)

Target: ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERP44 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERP44 Antibody

Purification: Affinity purified

Immunogen: TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TXNDC4 Blocking Peptide, (ABIN940411), is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERP44

Target: ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))

Alternative Name: TXNDC4

Background: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis, SARS-CoV-2 Protein Interactome