CSK antibody (Middle Region)

Catalog No. ABIN632232

Product Details anti-CSK Antibody

Target: CSK (C-Src tyrosine Kinase (CSK))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CSK antibody was raised against the middle region of CSK

Purification: Affinity purified

Immunogen: CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSK Blocking Peptide, catalog no. 33R-8387, is also available for use as a blocking control in assays to test for specificity of this CSK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSK

Target: CSK (C-Src tyrosine Kinase (CSK))

Alternative Name: CSK (CSK Products)

Synonyms: AW212630 antibody, C-terminal Src kinase antibody, c-src tyrosine kinase antibody, CSK, non-receptor tyrosine kinase antibody, CSK antibody, Csk antibody

Background: CSK specifically phosphorylates 'Tyr-504' on LCK, which acts as a negative regulatory site.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: TCR Signaling, EGFR Signaling Pathway, Cell-Cell Junction Organization, CXCR4-mediated Signaling Events