IL-33 antibody (N-Term)

Catalog No. ABIN632244

Product Details anti-IL-33 Antibody

Target: IL-33 (IL33) (Interleukin 33 (IL33))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-33 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL33 antibody was raised against the N terminal of IL33

Purification: Affinity purified

Immunogen: IL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL33 Blocking Peptide, catalog no. 33R-1291, is also available for use as a blocking control in assays to test for specificity of this IL33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-33

Target: IL-33 (IL33) (Interleukin 33 (IL33))

Alternative Name: IL33 (IL33 Products)

Synonyms: IL33 antibody, C9orf26 antibody, DVS27 antibody, IL1F11 antibody, NF-HEV antibody, NFEHEV antibody, RP11-575C20.2 antibody, 9230117N10Rik antibody, Il-33 antibody, Il1f11 antibody, RGD1311155 antibody, interleukin 33 antibody, IL33 antibody, Il33 antibody

Background: Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL33 induces T helper type 2-associated cytokines.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response