AP2B1 antibody (Middle Region)
-
- Target See all AP2B1 Antibodies
- AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AP2B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AP2 B1 antibody was raised against the middle region of AP2 1
- Purification
- Affinity purified
- Immunogen
- AP2 B1 antibody was raised using the middle region of AP2 1 corresponding to a region with amino acids DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI
- Top Product
- Discover our top product AP2B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AP2B1 Blocking Peptide, catalog no. 33R-2077, is also available for use as a blocking control in assays to test for specificity of this AP2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))
- Alternative Name
- AP2B1 (AP2B1 Products)
- Synonyms
- 5-HT(2B) antibody, 5-HT2B antibody, ADTB2 antibody, AP105B antibody, AP2-BETA antibody, CLAPB1 antibody, 1300012O03Rik antibody, AI788979 antibody, fa16e07 antibody, wu:fa16c06 antibody, wu:fa16e07 antibody, wu:fc18c08 antibody, zgc:55659 antibody, 5-hydroxytryptamine receptor 2B antibody, adaptor related protein complex 2 beta 1 subunit antibody, adaptor-related protein complex 2, beta 1 subunit antibody, adaptor related protein complex 2 beta 1 subunit L homeolog antibody, HTR2B antibody, AP2B1 antibody, Ap2b1 antibody, ap2b1 antibody, ap2b1.L antibody
- Background
- AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.
- Molecular Weight
- 105 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signaling Pathway, EGFR Downregulation
-