Nodal antibody
-
- Target See all Nodal (NODAL) Antibodies
- Nodal (NODAL) (Nodal Homolog (NODAL))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nodal antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH
- Top Product
- Discover our top product NODAL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NODAL Blocking Peptide, catalog no. 33R-2404, is also available for use as a blocking control in assays to test for specificity of this NODAL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NODAL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nodal (NODAL) (Nodal Homolog (NODAL))
- Alternative Name
- NODAL (NODAL Products)
- Synonyms
- NODAL antibody, Tg.413d antibody, HTX5 antibody, nodal4 antibody, nodal4-A antibody, nr4 antibody, xnr4 antibody, Xnr-1 antibody, nodal antibody, nr1 antibody, nr1-A antibody, nodal growth differentiation factor antibody, nodal homolog (mouse) antibody, nodal antibody, nodal growth differentiation factor L homeolog antibody, nodal homolog 1 L homeolog antibody, Nodal antibody, NODAL antibody, nodal.L antibody, nodal1.L antibody
- Background
- The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Stem Cell Maintenance, Tube Formation, Positive Regulation of Endopeptidase Activity
-