PRKACA antibody (N-Term)

Catalog No. ABIN633167

Product Details anti-PRKACA Antibody

Target: PRKACA (Protein Kinase A, alpha (PRKACA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKACA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKACA antibody was raised against the N terminal of PRKACA

Purification: Affinity purified

Immunogen: PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKACA Blocking Peptide, catalog no. 33R-5754, is also available for use as a blocking control in assays to test for specificity of this PRKACA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKACA

Target: PRKACA (Protein Kinase A, alpha (PRKACA))

Alternative Name: PRKACA (PRKACA Products)

Synonyms: PKACA antibody, Calpha antibody, Cs-PKA antibody, PKCA1 antibody, PKA antibody, PKCD antibody, Pkaca antibody, zgc:158799 antibody, protein kinase cAMP-activated catalytic subunit alpha antibody, protein kinase, cAMP dependent, catalytic, alpha antibody, cAMP-dependent protein kinase catalytic subunit antibody, protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a antibody, PRKACA antibody, Prkaca antibody, kin-1 antibody, prkacaa antibody

Background: CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Hedgehog Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Carbohydrate Homeostasis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Signaling Events mediated by VEGFR1 and VEGFR2, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGFR1 Specific Signals, Lipid Metabolism, SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection