FGF2 antibody
-
- Target See all FGF2 Antibodies
- FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FGF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Top Product
- Discover our top product FGF2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FGF2 Blocking Peptide, catalog no. 33R-8018, is also available for use as a blocking control in assays to test for specificity of this FGF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))
- Alternative Name
- FGF2 (FGF2 Products)
- Synonyms
- BFGF antibody, FGF-2 antibody, FGFB antibody, HBGF-2 antibody, Fgf-2 antibody, Fgfb antibody, bFGF antibody, fibroblast growth factor 2 antibody, fibroblast growth factor 2 (basic) antibody, FGF2 antibody, Fgf2 antibody, fgf2 antibody
- Background
- The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, C21-Steroid Hormone Metabolic Process, Inositol Metabolic Process, Glycosaminoglycan Metabolic Process, Protein targeting to Nucleus, S100 Proteins
-