RNMT antibody

Catalog No. ABIN633576

Product Details anti-RNMT Antibody

Target: RNMT (RNA Guanine-7 Methyltransferase (RNMT))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNMT antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RNMT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNMT Blocking Peptide, catalog no. 33R-8147, is also available for use as a blocking control in assays to test for specificity of this RNMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNMT

Target: RNMT (RNA Guanine-7 Methyltransferase (RNMT))

Alternative Name: RNMT (RNMT Products)

Synonyms: xCMT1 antibody, MET antibody, RG7MT1 antibody, hCMT1c antibody, 2610002P10Rik antibody, AI848273 antibody, Rg7mt1 antibody, mKIAA0398 antibody, rnmt antibody, im:6910566 antibody, wu:fi09c12 antibody, RNA (guanine-7-) methyltransferase L homeolog antibody, RNA guanine-7 methyltransferase antibody, RNA (guanine-7-) methyltransferase antibody, rnmt.L antibody, RNMT antibody, Rnmt antibody, rnmt antibody

Background: RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.

Molecular Weight: 55 kDa (MW of target protein)